LL37 5mg

Price range: $89.00 through $119.00

LL-37 (5mg) is a 37-amino acid cationic antimicrobial peptide (human cathelicidin) studied in immunology and regenerative research for its broad-spectrum antimicrobial activity, immunomodulatory effects, wound healing properties, and roles in innate immune defence. Herglowlabs supplies premium, >99% HPLC-verified LL-37 for laboratory use.

Please note: This product is strictly for in vitro laboratory research and is not intended for human consumption or veterinary use.

Earn up to 60 points.

Choose

Vial Only
Vial + Starter Kit

Clear

✦ Volume Savings

Buy 2

$84.55 / each

−5%

Buy 3

$80.10 / each

−10%

Buy 4 or more

$75.65 / each

−15%

Description

LL-37 5mg Australia – Cathelicidin Antimicrobial Peptide Research | Herglowlabs

Buy LL-37 5mg in Australia – Premium research-grade LL-37 (human cathelicidin) peptide at Herglowlabs. Widely used in studies on innate immunity, antimicrobial activity, wound healing, and inflammation modulation.

Key Highlights

Purity: >99% (Third-party HPLC Tested)
Form: Lyophilised Powder
Packaging: Sterile Vial
Intended Use: Strictly for in vitro laboratory research only. Not for human consumption.
Shipping: Fast Australia-Wide Express Delivery

Product Overview

LL-37 is a 37-amino acid cationic antimicrobial peptide derived from the human cathelicidin protein hCAP18. In laboratory research, LL-37 is studied for its broad-spectrum antimicrobial properties, immunomodulatory effects, wound healing capabilities, and roles in innate immune defence mechanisms.

Research Applications (Laboratory Use Only)

Researchers use LL-37 in studies exploring:

Antimicrobial and antifungal activity
Innate immune response and inflammation modulation
Wound healing and tissue repair processes
Angiogenesis and vascular biology
Autoimmune and inflammatory disease models

Note: This product is for research purposes only. No therapeutic or medical claims are made.

Storage & Handling

Store lyophilised powder below 25°C, protected from light and moisture.
Reconstitute with bacteriostatic water under sterile laboratory conditions.
Avoid repeated freeze-thaw cycles.

Why Choose Herglowlabs LL-37 5mg

High-purity antimicrobial research peptide
Independently tested batches with CoA available
Discreet, temperature-controlled Australian shipping
Fast Sydney/Melbourne dispatch
AU Owned & Operated

Technical Specifications

Attribute	Detail
Sequence	LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Purity	>99% (HPLC)
Appearance	White Lyophilised Powder
Form	Lyophilised Powder
Packaging	Sterile 5mg Vial

Disclaimer: This product is intended strictly for qualified laboratory research use only. It is not for human consumption, medical, veterinary, or household use. The buyer assumes full responsibility for proper handling and use.

Shipping Policy

At Herglowlabs, we aim to deliver your order quickly, safely, and reliably. All orders are shipped from our Sydney/Melbourne locations via Australia Post Express for fast, tracked delivery.

Shipping Rates

Free Express Shipping – Orders over $200 AUD
Flat Rate Express Shipping – $14.95 AUD for orders under $200

Delivery Times

Metro Areas: 2–4 business days
Regional Areas: 3–5 business days

Delivery timeframes are estimates provided by Australia Post and may vary depending on your location and seasonal demand.

Dispatch Times

Orders placed before 12:00 PM AEST are shipped the same business day
Orders placed after 12:00 PM or on weekends/public holidays will be dispatched the next business day

Tracking Your Order

Once your order has been shipped, you will receive an email with your Australia Post tracking number. You can track your order via the Australia Post website.

International Shipping

We currently ship within Australia and New Zealand only.

Order Issues & Delays

If your order is delayed, lost, or arrives damaged, please contact us within 48 hours of delivery so we can investigate and arrange a replacement if eligible under our Quality Assurance Guarantee.

Compliance

Intended Use:
This product is intended strictly for qualified laboratory researchers. It is not for human or veterinary consumption and must not be used as a drug, food additive, cosmetic, or household item.

Disclaimer:
This compound is sold for in vitro research and educational purposes only. It has not been evaluated by the FDA and is not intended to diagnose, treat, cure, or prevent any disease. All buyers must be authorized research personnel or institutions.

Terms of Sale:
By purchasing this product, you confirm that you are a qualified professional conducting lawful scientific research. Herglowlabs and its affiliates are not liable for any misuse or mishandling of this material.